} // If watching, pay attention to key presses, looking for right sequence. "event" : "MessagesWidgetAnswerForm", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "actions" : [ "event" : "MessagesWidgetAnswerForm", "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "eventActions" : [ { ] "parameters" : { { "action" : "rerender" Otherwise, click the link to log in with email. "actions" : [ "disableLinks" : "false", "actions" : [ watching = true; "action" : "pulsate" "disableLinks" : "false", return; "context" : "", "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", }, }, }, ] "buttonDialogCloseAlt" : "Schließen", } "entity" : "2044164", "action" : "rerender" } { } "actions" : [ "quiltName" : "ForumMessage", "event" : "kudoEntity", "useCountToKudo" : "false", ] "event" : "AcceptSolutionAction", ;(function($) { "action" : "rerender" "actions" : [ } "action" : "rerender" } }, }, "action" : "rerender" "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "expandMessage", }, Sollten Sie nichtsdestotrotz Skepsis wegen Callya aufladen online paypal empfinden, sind Sie offenbar bislang nicht angeregt genug, um konkret die Dinge zu verändern. "context" : "envParam:entity", "action" : "rerender" { "quiltName" : "ForumMessage", "actions" : [ } }, "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ { ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { if (typeof(Storage) !== "undefined") { } "forceSearchRequestParameterForBlurbBuilder" : "false", { "actions" : [ ], var element = $(this).parent('li'); "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XIXwHaqegRQRLu3s8gB9gdxnThbPojcMuR3P0NJMFOk. { }, { { { ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"NBNvxqIukSM5CTADafhJO1I5tUuI4ymSzo2PjXCJqjA. }, "componentId" : "kudos.widget.button", Bist du sicher, dass du fortfahren möchtest? "activecastFullscreen" : false, { "actions" : [ }); }); "event" : "expandMessage", } { })(LITHIUM.jQuery); "actions" : [ "action" : "pulsate" ] "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { } { "context" : "", "action" : "rerender" })(LITHIUM.jQuery); "actions" : [ "message" : "2044376", { "kudosLinksDisabled" : "false", "event" : "editProductMessage", return; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XIXwHaqegRQRLu3s8gB9gdxnThbPojcMuR3P0NJMFOk. "context" : "", "actions" : [ "context" : "envParam:feedbackData", "dialogContentCssClass" : "lia-panel-dialog-content", "context" : "", "event" : "AcceptSolutionAction", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "revokeMode" : "true", "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "actions" : [ "event" : "ProductAnswer", Anmeldung bei PayPal mit exisitierenden Konto -> ok. 3. } '; }, event.stopPropagation(); { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'HT5UKY_MrLx8KNUkiJbnB4_ooGilpncRz_6e8IZAkV4. { "context" : "", }, { }, } "action" : "rerender" "actions" : [ "context" : "envParam:selectedMessage", "actions" : [ { } "forceSearchRequestParameterForBlurbBuilder" : "false", { "event" : "ProductMessageEdit", }); "kudosLinksDisabled" : "false", // Oops. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "rerender" "includeRepliesModerationState" : "false", "parameters" : { "disableKudosForAnonUser" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { "event" : "MessagesWidgetEditCommentForm", OK. Browse categories close navigation menu PayPal Navigation. Unabhängig über App oder WebSeite (meinVodafone). ;(function($) { "action" : "rerender" ] } "context" : "", { { "actions" : [ "context" : "", { $('.lia-button-wrapper-searchForm-action').removeClass('active'); } } "disableLinks" : "false", "message" : "2044164", "context" : "lia-deleted-state", window.onclick = function(event) { "event" : "MessagesWidgetEditAction", }, LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.Dialog({ { "actions" : [ { "context" : "lia-deleted-state", }, "event" : "QuickReply", Resolve transaction or account issues. "actions" : [ }, lithstudio: [], "action" : "pulsate" "eventActions" : [ } "actions" : [ ;(function($) { '; count++; } ] "event" : "removeMessageUserEmailSubscription", } "context" : "", "context" : "", "context" : "envParam:quiltName", } { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "messageViewOptions" : "1111110111111111111110111110100101001101" "truncateBodyRetainsHtml" : "false", "}); ] }, element.siblings('li').find('li').removeClass('active'); }, // --> { { "event" : "removeThreadUserEmailSubscription", ] "message" : "2044362", "kudosable" : "true", "action" : "rerender" "actions" : [ "event" : "approveMessage", } ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "action" : "rerender" ] "event" : "ProductAnswerComment", Once you have a PayPal Business account, choose your theme and add your logo. "context" : "", ] "actions" : [ }, "context" : "envParam:quiltName", "context" : "", { Das ist schade, denn CallYa bietet Ihnen viele Vorteile: Keine Vertragsbindung, volle Kostenkontrolle und mit dem CallYa-Comfort vor allem sehr günstige Gesprächspreise. { "action" : "rerender" ] ] ', 'ajax'); "buttonDialogCloseAlt" : "Schließen", ', 'ajax'); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2044598,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "ProductAnswerComment", "context" : "", } }, }, "useCountToKudo" : "false", } "action" : "rerender" } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { { } "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName,message", return; "context" : "envParam:selectedMessage", ] { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { Sollte in den nächsten Wochen keine Aufbuchung auf Ihr CallYa-Konto erfolgen, gehen wir davon aus, dass Sie die Vorteile von CallYa leider nicht länger nutzen wollen und würden den Anschluss fristgerecht kündigen. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "componentId" : "kudos.widget.button", "messageViewOptions" : "1111110111111111111110111110100101001101" "action" : "rerender" "event" : "unapproveMessage", } else { ], "disallowZeroCount" : "false", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { ] "action" : "rerender" { "event" : "AcceptSolutionAction", } { notifCount = parseInt($(this).html()) + notifCount; "action" : "rerender"